Rat Ab1-40(Amyloid Beta Peptide 1-40) ELISA Kit
To Order Contact us: [email protected]
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 600 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 830.4 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 613.2 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 850.8 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 573.6 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 794.4 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 586.8 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 812.4 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Ra-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 5552.14 |
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Ra-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 562.42 |
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Ra-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 752.02 |
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Ra-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 3024.07 |
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
4-CEA864Ra |
Cloud-Clone |
-
EUR 5612.40
-
EUR 2965.20
-
EUR 752.40
|
- 10 plates of 96 wells
- 5 plates of 96 wells
- 1 plate of 96 wells
|
|
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
20-abx155127 |
Abbexa |
-
EUR 8684.40
-
EUR 4626.00
-
EUR 1074.00
|
- 10 × 96 tests
- 5 × 96 tests
- 96 tests
|
|
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
20-abx053396 |
Abbexa |
-
EUR 8684.40
-
EUR 4626.00
-
EUR 1074.00
|
- 10 × 96 tests
- 5 × 96 tests
- 96 tests
|
|
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
abx256723-96tests |
Abbexa |
96 tests |
EUR 801.6 |
|
Rat Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40) |
RK03455 |
Abclonal |
96 Tests |
EUR 625.2 |
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody |
20-abx175368 |
Abbexa |
-
EUR 477.60
-
EUR 159.60
-
EUR 1312.80
-
EUR 644.40
-
EUR 376.80
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody |
20-abx175369 |
Abbexa |
-
EUR 493.20
-
EUR 159.60
-
EUR 1362.00
-
EUR 661.20
-
EUR 376.80
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody |
20-abx132222 |
Abbexa |
-
EUR 510.00
-
EUR 159.60
-
EUR 1412.40
-
EUR 693.60
-
EUR 393.60
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Synthetic Amyloid Beta Peptide 1-40 (Ab1-40) |
4-SPA864Hu02 |
Cloud-Clone |
-
EUR 421.06
-
EUR 236.40
-
EUR 1248.96
-
EUR 496.32
-
EUR 872.64
-
EUR 357.60
-
EUR 2942.40
|
- 100 ug
- 10ug
- 1 mg
- 200 ug
- 500 ug
- 50ug
- 5 mg
|
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: E.coli |
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide |
20-abx652283 |
Abbexa |
-
EUR 376.80
-
EUR 243.60
-
EUR 927.60
-
EUR 410.40
-
EUR 309.60
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide |
abx670346-1mg |
Abbexa |
1 mg |
EUR 627.6 |
|
Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA) |
20-abx651149 |
Abbexa |
-
EUR 376.80
-
EUR 243.60
-
EUR 927.60
-
EUR 410.40
-
EUR 309.60
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA) |
20-abx651150 |
Abbexa |
-
EUR 376.80
-
EUR 243.60
-
EUR 927.60
-
EUR 410.40
-
EUR 309.60
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH) |
20-abx651151 |
Abbexa |
-
EUR 410.40
-
EUR 260.40
-
EUR 1078.80
-
EUR 493.20
-
EUR 326.40
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Rat Amyloid Beta Peptide 1-40 (Ab1-40) CLIA Kit |
20-abx490289 |
Abbexa |
-
EUR 10282.80
-
EUR 5472.00
-
EUR 1262.40
|
- 10 × 96 tests
- 5 × 96 tests
- 96 tests
|
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Hu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 5128.02 |
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Hu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 527.48 |
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Hu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 702.12 |
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Hu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2799.54 |
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
4-CEA864Hu |
Cloud-Clone |
-
EUR 5188.80
-
EUR 2739.60
-
EUR 703.20
|
- 10 plates of 96 wells
- 5 plates of 96 wells
- 1 plate of 96 wells
|
|
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Mu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 5269.39 |
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Mu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 539.12 |
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Mu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 718.75 |
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Mu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2874.38 |
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
4-CEA864Mu |
Cloud-Clone |
-
EUR 5330.40
-
EUR 2815.20
-
EUR 718.80
|
- 10 plates of 96 wells
- 5 plates of 96 wells
- 1 plate of 96 wells
|
|
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
20-abx150496 |
Abbexa |
-
EUR 7970.40
-
EUR 4250.40
-
EUR 990.00
|
- 10 × 96 tests
- 5 × 96 tests
- 96 tests
|
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
20-abx153576 |
Abbexa |
-
EUR 7970.40
-
EUR 4250.40
-
EUR 990.00
|
- 10 × 96 tests
- 5 × 96 tests
- 96 tests
|
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
abx053393-96tests |
Abbexa |
96 tests |
EUR 801.6 |
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
20-abx053394 |
Abbexa |
-
EUR 8365.20
-
EUR 4456.80
-
EUR 1036.80
|
- 10 × 96 tests
- 5 × 96 tests
- 96 tests
|
|
Monkey Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
abx353340-96tests |
Abbexa |
96 tests |
EUR 990 |
|
Pig Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
abx361651-96tests |
Abbexa |
96 tests |
EUR 990 |
|
Rabbit Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
abx362577-96tests |
Abbexa |
96 tests |
EUR 990 |
|
Chicken Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
abx357155-96tests |
Abbexa |
96 tests |
EUR 990 |
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
abx255205-96tests |
Abbexa |
96 tests |
EUR 801.6 |
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
ED1031-096 |
GenDepot |
96T |
EUR 1064.4 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
ED1032-096 |
GenDepot |
96T |
EUR 1113.6 |
Human Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40) |
RK00784 |
Abclonal |
96 Tests |
EUR 625.2 |
Mouse Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40) |
RK02558 |
Abclonal |
96 Tests |
EUR 625.2 |
ELISA kit for Rat Ab1-40 (Amyloid Beta Peptide 1-40) |
ELK1494 |
ELK Biotech |
1 plate of 96 wells |
EUR 518.4 |
|
Description: A competitive Inhibition ELISA kit for detection of Amyloid Beta Peptide 1-40 from Rat in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Hu11 |
Cloud-Clone |
-
EUR 266.23
-
EUR 194.40
-
EUR 668.35
-
EUR 302.78
-
EUR 485.57
-
EUR 253.20
-
EUR 1490.88
|
- 100 ug
- 10ug
- 1 mg
- 200 ug
- 500 ug
- 50ug
- 5 mg
|
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
OVA conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Hu21 |
Cloud-Clone |
-
EUR 517.82
-
EUR 261.60
-
EUR 1611.84
-
EUR 617.28
-
EUR 1114.56
-
EUR 422.40
-
EUR 3849.60
|
- 100 ug
- 10ug
- 1 mg
- 200 ug
- 500 ug
- 50ug
- 5 mg
|
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Hu23 |
Cloud-Clone |
-
EUR 409.22
-
EUR 232.80
-
EUR 1204.61
-
EUR 481.54
-
EUR 843.07
-
EUR 349.20
-
EUR 2831.52
|
- 100 ug
- 10ug
- 1 mg
- 200 ug
- 500 ug
- 50ug
- 5 mg
|
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Hu31 |
Cloud-Clone |
-
EUR 295.26
-
EUR 202.80
-
EUR 777.22
-
EUR 339.07
-
EUR 558.14
-
EUR 272.40
-
EUR 1763.04
|
- 100 ug
- 10ug
- 1 mg
- 200 ug
- 500 ug
- 50ug
- 5 mg
|
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Mu11 |
Cloud-Clone |
-
EUR 266.23
-
EUR 194.40
-
EUR 668.35
-
EUR 302.78
-
EUR 485.57
-
EUR 253.20
-
EUR 1490.88
|
- 100 ug
- 10ug
- 1 mg
- 200 ug
- 500 ug
- 50ug
- 5 mg
|
|
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Mu21 |
Cloud-Clone |
-
EUR 266.23
-
EUR 194.40
-
EUR 668.35
-
EUR 302.78
-
EUR 485.57
-
EUR 253.20
-
EUR 1490.88
|
- 100 ug
- 10ug
- 1 mg
- 200 ug
- 500 ug
- 50ug
- 5 mg
|
|
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Mu31 |
Cloud-Clone |
-
EUR 295.26
-
EUR 202.80
-
EUR 777.22
-
EUR 339.07
-
EUR 558.14
-
EUR 272.40
-
EUR 1763.04
|
- 100 ug
- 10ug
- 1 mg
- 200 ug
- 500 ug
- 50ug
- 5 mg
|
|
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Ra11 |
Cloud-Clone |
-
EUR 266.23
-
EUR 194.40
-
EUR 668.35
-
EUR 302.78
-
EUR 485.57
-
EUR 253.20
-
EUR 1490.88
|
- 100 ug
- 10ug
- 1 mg
- 200 ug
- 500 ug
- 50ug
- 5 mg
|
|
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Ra21 |
Cloud-Clone |
-
EUR 266.23
-
EUR 194.40
-
EUR 668.35
-
EUR 302.78
-
EUR 485.57
-
EUR 253.20
-
EUR 1490.88
|
- 100 ug
- 10ug
- 1 mg
- 200 ug
- 500 ug
- 50ug
- 5 mg
|
|
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Ra31 |
Cloud-Clone |
-
EUR 295.26
-
EUR 202.80
-
EUR 777.22
-
EUR 339.07
-
EUR 558.14
-
EUR 272.40
-
EUR 1763.04
|
- 100 ug
- 10ug
- 1 mg
- 200 ug
- 500 ug
- 50ug
- 5 mg
|
|
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat) |
4-PAA864Ra08 |
Cloud-Clone |
-
EUR 291.60
-
EUR 2948.40
-
EUR 735.60
-
EUR 366.00
-
EUR 254.40
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40) |
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA) |
20-abx165634 |
Abbexa |
-
EUR 727.20
-
EUR 309.60
-
EUR 2180.40
-
EUR 861.60
-
EUR 526.80
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA) |
20-abx651143 |
Abbexa |
-
EUR 376.80
-
EUR 243.60
-
EUR 927.60
-
EUR 410.40
-
EUR 309.60
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA) |
20-abx651144 |
Abbexa |
-
EUR 577.20
-
EUR 292.80
-
EUR 1646.40
-
EUR 678.00
-
EUR 410.40
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH) |
20-abx651145 |
Abbexa |
-
EUR 410.40
-
EUR 260.40
-
EUR 1078.80
-
EUR 493.20
-
EUR 326.40
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA) |
20-abx651146 |
Abbexa |
-
EUR 376.80
-
EUR 243.60
-
EUR 927.60
-
EUR 410.40
-
EUR 309.60
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA) |
20-abx651147 |
Abbexa |
-
EUR 376.80
-
EUR 243.60
-
EUR 927.60
-
EUR 410.40
-
EUR 309.60
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH) |
20-abx651148 |
Abbexa |
-
EUR 410.40
-
EUR 260.40
-
EUR 1078.80
-
EUR 493.20
-
EUR 326.40
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) CLIA Kit |
20-abx490287 |
Abbexa |
-
EUR 9567.60
-
EUR 5095.20
-
EUR 1177.20
|
- 10 × 96 tests
- 5 × 96 tests
- 96 tests
|
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) CLIA Kit |
20-abx490288 |
Abbexa |
-
EUR 9567.60
-
EUR 5095.20
-
EUR 1177.20
|
- 10 × 96 tests
- 5 × 96 tests
- 96 tests
|
|
ELISA kit for Human Ab1-40 (Amyloid Beta Peptide 1-40) |
ELK1492 |
ELK Biotech |
1 plate of 96 wells |
EUR 518.4 |
|
Description: A competitive Inhibition ELISA kit for detection of Amyloid Beta Peptide 1-40 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
ELISA kit for Mouse Ab1-40 (Amyloid Beta Peptide 1-40) |
ELK1493 |
ELK Biotech |
1 plate of 96 wells |
EUR 518.4 |
|
Description: A competitive Inhibition ELISA kit for detection of Amyloid Beta Peptide 1-40 from Mouse in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), APC |
4-PAA864Ra08-APC |
Cloud-Clone |
-
EUR 408.00
-
EUR 3843.60
-
EUR 1072.80
-
EUR 518.40
-
EUR 260.40
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with APC. |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), Biotinylated |
4-PAA864Ra08-Biotin |
Cloud-Clone |
-
EUR 368.40
-
EUR 2888.40
-
EUR 856.80
-
EUR 450.00
-
EUR 260.40
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with Biotin. |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), Cy3 |
4-PAA864Ra08-Cy3 |
Cloud-Clone |
-
EUR 493.20
-
EUR 5074.80
-
EUR 1381.20
-
EUR 642.00
-
EUR 297.60
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with Cy3. |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), FITC |
4-PAA864Ra08-FITC |
Cloud-Clone |
-
EUR 350.40
-
EUR 3098.40
-
EUR 882.00
-
EUR 439.20
-
EUR 232.80
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with FITC. |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), HRP |
4-PAA864Ra08-HRP |
Cloud-Clone |
-
EUR 373.20
-
EUR 3350.40
-
EUR 949.20
-
EUR 469.20
-
EUR 246.00
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with HRP. |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), PE |
4-PAA864Ra08-PE |
Cloud-Clone |
-
EUR 350.40
-
EUR 3098.40
-
EUR 882.00
-
EUR 439.20
-
EUR 232.80
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with PE. |
Amyloid Beta-Peptide (1-40) (human) |
A1124-1 |
ApexBio |
1 mg |
EUR 226.8 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), APC-Cy7 |
4-PAA864Ra08-APC-Cy7 |
Cloud-Clone |
-
EUR 672.00
-
EUR 7543.20
-
EUR 2002.80
-
EUR 894.00
-
EUR 378.00
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with APC-Cy7. |
Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
1-CSB-E08302r |
Cusabio |
-
EUR 1160.40
-
EUR 7110.00
-
EUR 3760.80
|
- 1 plate of 96 wells
- 10 plates of 96 wells each
- 5 plates of 96 wells each
|
|
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Rat amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
CN-01866R1 |
ChemNorm |
96T |
EUR 592.8 |
Rat amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
GA-E0101RT-48T |
GenAsia Biotech |
48T |
EUR 380.4 |
Rat amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
GA-E0101RT-96T |
GenAsia Biotech |
96T |
EUR 595.2 |
Mouse beta-40(Amyloid Beta Peptide 1-40)ELISA Kit |
STJ150003 |
St John's Laboratory |
1 kit |
EUR 494.4 |
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Mouse serum, plasma and other biological fluids |
Human beta-40(Amyloid Beta Peptide 1-40) ELISA Kit |
STJ150127 |
St John's Laboratory |
1 kit |
EUR 494.4 |
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in human serum, plasma and other biological fluids |
Rat beta-40(Amyloid Beta 1-40) ELISA Kit |
STJ150091 |
St John's Laboratory |
1 kit |
EUR 494.4 |
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Rat serum, plasma and other biological fluids |
Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
CSB-E08302r-24T |
Cusabio |
1 plate of 24 wells |
EUR 198 |
|
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
1-CSB-E08299h |
Cusabio |
-
EUR 1080.00
-
EUR 6571.20
-
EUR 3480.00
|
- 1 plate of 96 wells
- 10 plates of 96 wells each
- 5 plates of 96 wells each
|
|
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid(CSF). Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Mouse amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
1-CSB-E08300m |
Cusabio |
-
EUR 1135.20
-
EUR 6938.40
-
EUR 3672.00
|
- 1 plate of 96 wells
- 10 plates of 96 wells each
- 5 plates of 96 wells each
|
|
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
CN-00638R1 |
ChemNorm |
96T |
EUR 577.2 |
Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
CN-00638R2 |
ChemNorm |
48T |
EUR 398.4 |
Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
CN-02744M1 |
ChemNorm |
96T |
EUR 553.2 |
Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
CN-02744M2 |
ChemNorm |
48T |
EUR 372 |
Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
CN-03356H1 |
ChemNorm |
96T |
EUR 544.8 |
Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
CN-03356H2 |
ChemNorm |
48T |
EUR 363.6 |
Horse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
CN-05164H1 |
ChemNorm |
96T |
EUR 556.8 |
Mouse amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
GA-E0318MS-48T |
GenAsia Biotech |
48T |
EUR 403.2 |
Mouse amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
GA-E0318MS-96T |
GenAsia Biotech |
96T |
EUR 640.8 |
Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
GA-E0086PC-48T |
GenAsia Biotech |
48T |
EUR 436.8 |
Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
GA-E0086PC-96T |
GenAsia Biotech |
96T |
EUR 708 |
Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
GA-E0029RB-48T |
GenAsia Biotech |
48T |
EUR 391.2 |
Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
GA-E0029RB-96T |
GenAsia Biotech |
96T |
EUR 628.8 |
Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
GA-E1247HM-48T |
GenAsia Biotech |
48T |
EUR 346.8 |
Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
GA-E1247HM-96T |
GenAsia Biotech |
96T |
EUR 559.2 |
Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
YLA0171PO-48T |
Shanghai YL Biotech |
48T |
EUR 502.5 |
Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
YLA0171PO-96T |
Shanghai YL Biotech |
96T |
EUR 618.75 |
Canine Amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
YLA0030CA-48T |
Shanghai YL Biotech |
48T |
EUR 502.5 |
Canine Amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
YLA0030CA-96T |
Shanghai YL Biotech |
96T |
EUR 618.75 |
Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
YLA1751HU-96T |
Shanghai YL Biotech |
96T |
EUR 562.5 |
Rat amyloid beta peptide 1-40 ELISA kit |
E02A0910-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A competitive ELISA for quantitative measurement of Rat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rat amyloid beta peptide 1-40 ELISA kit |
E02A0910-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A competitive ELISA for quantitative measurement of Rat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rat amyloid beta peptide 1-40 ELISA kit |
E02A0910-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A competitive ELISA for quantitative measurement of Rat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Abeta 40 (beta amyloid 1-40) |
RA25009 |
Neuromics |
100 ul |
EUR 459.6 |
Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
CSB-E08299h-24T |
Cusabio |
1 plate of 24 wells |
EUR 198 |
|
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid (CSF). A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Mouse amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
CSB-E08300m-24T |
Cusabio |
1 plate of 24 wells |
EUR 198 |
|
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Human amyloid beta peptide 1-40,A?1-40 ELISA Kit |
201-12-1231 |
SunredBio |
96 tests |
EUR 528 |
|
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
ELISA kit for Rat Amyloid Beta Peptide 1-40 (ABeta 1-40) Kit |
KTE101179-48T |
Abbkine |
48T |
EUR 424.8 |
Description: Quantitative sandwich ELISA for measuring Rat Amyloid Beta Peptide 1-40 (ABeta 1-40) Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Rat Amyloid Beta Peptide 1-40 (ABeta 1-40) Kit |
KTE101179-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2702.4 |
Description: Quantitative sandwich ELISA for measuring Rat Amyloid Beta Peptide 1-40 (ABeta 1-40) Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Rat Amyloid Beta Peptide 1-40 (ABeta 1-40) Kit |
KTE101179-96T |
Abbkine |
96T |
EUR 686.4 |
Description: Quantitative sandwich ELISA for measuring Rat Amyloid Beta Peptide 1-40 (ABeta 1-40) Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
Amyloid Beta-Peptide (1-40) (human) |
A1124-10 |
ApexBio |
10 mg |
EUR 895.2 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Amyloid Beta-Peptide (1-40) (human) |
A1124-25 |
ApexBio |
25 mg |
EUR 1228.8 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Amyloid Beta-Peptide (1-40) (human) |
A1124-5 |
ApexBio |
5 mg |
EUR 560.4 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Rat Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
DLR-Ab1-42-Ra-48T |
DL Develop |
48T |
EUR 609.6 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-42 (Ab1-42) in samples from serum, plasma or other biological fluids. |
Rat Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
DLR-Ab1-42-Ra-96T |
DL Develop |
96T |
EUR 793.2 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-42 (Ab1-42) in samples from serum, plasma or other biological fluids. |
Rat Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
RDR-Ab1-42-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 640.8 |
Rat Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
RDR-Ab1-42-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 890.4 |
Rat Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
RD-Ab1-42-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 613.2 |
Rat Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
RD-Ab1-42-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 850.8 |
Human amyloid beta peptide 1-40 ELISA kit |
E01A0910-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human amyloid beta peptide 1-40 ELISA kit |
E01A0910-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human amyloid beta peptide 1-40 ELISA kit |
E01A0910-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Pig amyloid beta peptide 1-40 ELISA kit |
E07A0910-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A competitive ELISA for quantitative measurement of Porcine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Pig amyloid beta peptide 1-40 ELISA kit |
E07A0910-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A competitive ELISA for quantitative measurement of Porcine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Pig amyloid beta peptide 1-40 ELISA kit |
E07A0910-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A competitive ELISA for quantitative measurement of Porcine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rabbit amyloid beta peptide 1-40 ELISA kit |
E04A0910-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rabbit amyloid beta peptide 1-40 ELISA kit |
E04A0910-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rabbit amyloid beta peptide 1-40 ELISA kit |
E04A0910-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat amyloid beta peptide 1-40 ELISA kit |
E06A0910-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A competitive ELISA for quantitative measurement of Goat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat amyloid beta peptide 1-40 ELISA kit |
E06A0910-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A competitive ELISA for quantitative measurement of Goat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat amyloid beta peptide 1-40 ELISA kit |
E06A0910-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A competitive ELISA for quantitative measurement of Goat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Monkey amyloid beta peptide 1-40 ELISA kit |
E09A0910-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A competitive ELISA for quantitative measurement of Monkey amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Monkey amyloid beta peptide 1-40 ELISA kit |
E09A0910-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A competitive ELISA for quantitative measurement of Monkey amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Monkey amyloid beta peptide 1-40 ELISA kit |
E09A0910-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A competitive ELISA for quantitative measurement of Monkey amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog amyloid beta peptide 1-40 ELISA kit |
E08A0910-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A competitive ELISA for quantitative measurement of Canine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog amyloid beta peptide 1-40 ELISA kit |
E08A0910-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A competitive ELISA for quantitative measurement of Canine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog amyloid beta peptide 1-40 ELISA kit |
E08A0910-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A competitive ELISA for quantitative measurement of Canine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse amyloid beta peptide 1-40 ELISA kit |
E03A0910-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A competitive ELISA for quantitative measurement of Mouse amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse amyloid beta peptide 1-40 ELISA kit |
E03A0910-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A competitive ELISA for quantitative measurement of Mouse amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse amyloid beta peptide 1-40 ELISA kit |
E03A0910-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A competitive ELISA for quantitative measurement of Mouse amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Equine amyloid beta peptide 1- 40 ELISA Kit |
ELA-E0864ELA-Eq |
Lifescience Market |
96 Tests |
EUR 1113.6 |
Human amyloid beta peptide 1- 40 ELISA Kit |
ELA-E0864h |
Lifescience Market |
96 Tests |
EUR 988.8 |
Monkey amyloid beta peptide 1- 40 ELISA Kit |
ELA-E0864Mo |
Lifescience Market |
96 Tests |
EUR 1113.6 |
Rabbit amyloid beta peptide 1- 40 ELISA Kit |
ELA-E0864Rb |
Lifescience Market |
96 Tests |
EUR 1113.6 |
ELISA kit for Rat A?1-40 (Amyloid Beta 1-40) |
E-EL-R1401 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 452.4 |
|
Description: A sandwich ELISA kit for quantitative measurement of Rat A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant |
Mouse/Rat Amyloid-beta (AB1-40) ELISA Kit, 96 tests, Quantitative |
200-105-A40 |
Alpha Diagnostics |
1 kit |
EUR 1074 |
Human Amyloid-beta (AB1-40) ELISA Kit, 96 tests, Quantitative |
200-100-A40 |
Alpha Diagnostics |
1 kit |
EUR 973.2 |
Rat beta-Amyloid 1-40 (full length) peptide |
BAM405-P1 |
Alpha Diagnostics |
1 mg |
EUR 489.6 |
Human Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
DLR-Ab1-42-Hu-48T |
DL Develop |
48T |
EUR 574.8 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-42 (Ab1-42) in samples from serum, plasma or other biological fluids. |
Human Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
DLR-Ab1-42-Hu-96T |
DL Develop |
96T |
EUR 745.2 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-42 (Ab1-42) in samples from serum, plasma or other biological fluids. |
Mouse Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
DLR-Ab1-42-Mu-48T |
DL Develop |
48T |
EUR 586.8 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-42 (Ab1-42) in samples from serum, plasma or other biological fluids. |
Mouse Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
DLR-Ab1-42-Mu-96T |
DL Develop |
96T |
EUR 762 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-42 (Ab1-42) in samples from serum, plasma or other biological fluids. |
Human Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
RDR-Ab1-42-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 600 |
Human Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
RDR-Ab1-42-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 830.4 |
Mouse Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
RDR-Ab1-42-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 613.2 |
Mouse Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
RDR-Ab1-42-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 850.8 |
Human Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
RD-Ab1-42-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 573.6 |
Human Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
RD-Ab1-42-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 794.4 |
Mouse Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
RD-Ab1-42-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 586.8 |
Mouse Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
RD-Ab1-42-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 812.4 |
Rat amyloid beta peptide 1-40,Aβ1-41 ELISA Kit |
CN-01866R2 |
ChemNorm |
48T |
EUR 412.8 |
FUNNEL, 40 MM, PP |
6120P-40 |
CORNING |
24/pk |
EUR 52.8 |
Description: Reusable Plastics; Reusable Funnels |
Guinea pig amyloid beta peptide 1-40 ELISA kit |
E05A0910-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A competitive ELISA for quantitative measurement of Guinea pig amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Guinea pig amyloid beta peptide 1-40 ELISA kit |
E05A0910-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A competitive ELISA for quantitative measurement of Guinea pig amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Guinea pig amyloid beta peptide 1-40 ELISA kit |
E05A0910-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A competitive ELISA for quantitative measurement of Guinea pig amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
[Gln11] -beta- Amyloid (1 - 40) |
5-00187 |
CHI Scientific |
4 x 1mg |
Ask for price |
[Gln22] -beta- Amyloid (1 - 40) |
5-00190 |
CHI Scientific |
4 x 1mg |
Ask for price |
[Gly22] -beta- Amyloid (1 - 40) |
5-00201 |
CHI Scientific |
4 x 1mg |
Ask for price |
Cys-beta- Amyloid (1 - 40) |
5-01014 |
CHI Scientific |
4 x 1mg |
Ask for price |
Amyloid beta (1-40) Antibody |
abx020617-100ug |
Abbexa |
100 ug |
EUR 1178.4 |
|
beta Amyloid 40 protein |
30R-3013 |
Fitzgerald |
500 ug |
EUR 392.4 |
Description: Purified recombinant beta Amyloid 40 protein |
Amyloid beta 40 antibody |
10R-8435 |
Fitzgerald |
100 ul |
EUR 471.6 |
Description: Mouse monoclonal Amyloid beta 40 antibody |
ELISA kit for Human A?1-40 (Amyloid Beta 1-40) |
E-EL-H0542 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 452.4 |
|
Description: A sandwich ELISA kit for quantitative measurement of Human A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant |
Rat Ab1-40(Amyloid Beta Peptide 1-40) ELISA Kit